NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310130_0000418

Scaffold Ga0310130_0000418


Overview

Basic Information
Taxon OID3300034073 Open in IMG/M
Scaffold IDGa0310130_0000418 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)34632
Total Scaffold Genes64 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (28.12%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016369Metagenome247Y
F072270Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0310130_0000418_27186_27653F016369N/AVKRSKAFTLIELVLAITILLGIIGAIVINYDSLVGNTRYFEARENLKTYLINLKYQSAFRQKEFELTFDPDYNMYSSFEDFYLLDAVTNDLKILETSATKIVFFLDGSVQESYIVTSNLEGTITNKFIINVIGEVKYEGYTNDIIENKESEVQTE
Ga0310130_0000418_5682_6407F072270AGAAGMNLDIKFVELPQEPYKVPMKLEKTTLNLFLKHLPTSSVLEYLIELLPKCTENGPWIAGGCLHRTYRKLPLTNADVDVFFKNKEQFEKFVYDLSVSSVTAGYIKIESTIYSEWHCTLTIKYMDVDWKIQCVTFKYFDNIEELFKSFDINVCRIAYDGTNVVYENGILDDIKTNKLKFNEGSIYYPSVTLKRLVKYIKMGYDVEDVDLKLLTHAFYKSKKKAIDILDQDLATKKPIETYKGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.