NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335019_0126545

Scaffold Ga0335019_0126545


Overview

Basic Information
Taxon OID3300034066 Open in IMG/M
Scaffold IDGa0335019_0126545 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1697
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008943Metagenome / Metatranscriptome325Y
F010764Metagenome / Metatranscriptome299Y
F091921Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0335019_0126545_1535_1690F010764GGAGMIEVKKSYVVELTEQQAKELYWILKDVDLGVDNELKLVYHELKKLFDSGIR
Ga0335019_0126545_291_512F008943GGAGGMKNFNEIDWAVLFVFFIAIVAGAIITYDAQQQRVLFQQTYNKNLECRQALKDQTVGRVNEICGDVPAIGAFVK
Ga0335019_0126545_760_933F091921GGAGMIELRIVENELGMKSDIQYRFMLFTTDVSGSLCPPNPDMKWSEWRTAEYVKAEEIEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.