NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334995_0004925

Scaffold Ga0334995_0004925


Overview

Basic Information
Taxon OID3300034062 Open in IMG/M
Scaffold IDGa0334995_0004925 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13386
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)33 (86.84%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F035281Metagenome / Metatranscriptome172Y
F059898Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0334995_0004925_11085_11300F035281AGGAGMKNFILMIAIATACSTTFAGECANGTCTLRNRVVNVTREIVSVPVQVTKRTVEATRNFGRRSVARVRSVVR
Ga0334995_0004925_2969_3673F000325AGGAGMKVANGNDKLGKGCLVVSRPVGDTCPNTCAFLHNGCYAEQTEKMYPGVRPAGMKNVITEKHRIRSMILDAIRQGKSIRWHERGDWFLNGELDLDYVANVTDACESILADGTKLPDMWFYTHIYDSRLVSLEKYMNVYASIHNDQDMGEALAQGFKLFAWCDSDQKIAPKRPRNKAKADAWRASLPKLVVLNGTKFVTCPEIRRGRGVVTCTPTKGSVTCDLCVRGLANVLFPSH
Ga0334995_0004925_682_849F059898GGAGGMNRDQAMVYIINFFNSRMSAMSKNNVDKAKELIGLHEISAPELINKYVELVYENS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.