NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334987_0135146

Scaffold Ga0334987_0135146


Overview

Basic Information
Taxon OID3300034061 Open in IMG/M
Scaffold IDGa0334987_0135146 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1831
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000447Metagenome / Metatranscriptome1128Y
F001562Metagenome / Metatranscriptome670Y
F007263Metagenome / Metatranscriptome354Y

Sequences

Protein IDFamilyRBSSequence
Ga0334987_0135146_111_281F007263GAGGMLDTKYIDQTEFYFIKDEIKFHCDESQFVYVCKEHGEQMGCYYCEFNYDEKCECEG
Ga0334987_0135146_1_111F000447GAGMGYIEIFRMDQDGAGWVDLSEATPDELFTIEVGLLNE
Ga0334987_0135146_886_1083F001562GAGGMEKTQFEKDLEIKESFIDLLNDCYPSVKIGYSTFTPAEILECCDPVAFAIGLVEHEDYLAEMENE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.