NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334986_0009090

Scaffold Ga0334986_0009090


Overview

Basic Information
Taxon OID3300034012 Open in IMG/M
Scaffold IDGa0334986_0009090 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7237
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004344Metagenome / Metatranscriptome442Y
F071184Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0334986_0009090_2_247F004344AGGGGGMDGLNVKVKTTDGVEATYSLRPRIIVDFEQKYGKGLAKLLGEEQKLEHIYYLGWLALRANGKVVKPFGPDFLDTLEAVSLDT
Ga0334986_0009090_6932_7237F071184N/APADPQSVYEVNSREARSEQPHMVLQVPEPTVNVAAPNVTIEPAMVMLESPQVNVEAPNVSVDAPTVNVTNTIERKRVRKKIIRDENNLIVEVIEEFIEGQE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.