| Basic Information | |
|---|---|
| Taxon OID | 3300033997 Open in IMG/M |
| Scaffold ID | Ga0310131_009353 Open in IMG/M |
| Source Dataset Name | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4158 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 35.784 | Long. (o) | -98.26 | Alt. (m) | Depth (m) | 2896 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011293 | Metagenome | 292 | Y |
| F049592 | Metagenome | 146 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310131_009353_1515_1763 | F049592 | GAG | MVTWHDAHTIDNDEWHELADLKDEPCVVSSIGYLLSRRNARHLILAQSLTDDKGVDNVLFIPNRMVRKVVRLQIPHKRRKVR |
| Ga0310131_009353_2599_2952 | F011293 | GGA | MSSNIDPGDAAYRAWQLTNGDRMAQYGHPWVDYTAVRRIFGVLTNFKHNLTVQEAIMFMVAVKLARLMKSLGEEKLHEDSLVDAIGYLNCLHMADARDVLHDAPKHIIGDMAIEWER |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |