NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334965_0018837

Scaffold Ga0334965_0018837


Overview

Basic Information
Taxon OID3300033991 Open in IMG/M
Scaffold IDGa0334965_0018837 Open in IMG/M
Source Dataset NameSediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3605
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameCroatia: Zadar
CoordinatesLat. (o)43.9359Long. (o)15.5428Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065377Metagenome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0334965_0018837_1863_2375F065377AGGAGGMALEMPEDIKDLVYKTWMPALMTTVFEAIKGLPAKQRKAILTKICITCEDMAMAGALGIQPGMSWNDYVKFVKEAPAPVGPWTIKKSKSGDVFDLIDDATVGDDGKPLCHCPFVLLGIREPLPECCDSGARLSGKMIAAATKKKVAKTEVIDSPARTGAAVCHYRVKVKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.