NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334965_0008815

Scaffold Ga0334965_0008815


Overview

Basic Information
Taxon OID3300033991 Open in IMG/M
Scaffold IDGa0334965_0008815 Open in IMG/M
Source Dataset NameSediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5763
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameCroatia: Zadar
CoordinatesLat. (o)43.9359Long. (o)15.5428Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065251Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0334965_0008815_5589_5744F065251N/AMYLRSFTKNGKKYYYIAKAVRKGDKVIQKSILYVGTADTMYKKLIGLKQKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.