NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334977_0005215

Scaffold Ga0334977_0005215


Overview

Basic Information
Taxon OID3300033978 Open in IMG/M
Scaffold IDGa0334977_0005215 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7384
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (76.19%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000714Metagenome / Metatranscriptome924Y
F001125Metagenome / Metatranscriptome769Y
F013184Metagenome / Metatranscriptome273Y

Sequences

Protein IDFamilyRBSSequence
Ga0334977_0005215_1373_1642F000263AGGMTPEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLIAEQDLASALEQEELSEEAMDSMVRTECEGRLDMLVELYQLTYQLSFAIGARTL
Ga0334977_0005215_2386_2559F013184GGAGMNRYGFVIKLEGAVMANNEKEAHEKINLHLNDLGEVDSARYDLNWPDVSWDMEYDLL
Ga0334977_0005215_3889_4257F001125AGGCGGMGDRANFGFKDRKGDTIFLYGHWAGHRMLENLANAVEQARPRWSDESYATRICVSQLVNEEWASETGWGLSVNELSDNEHKVPVIDWANKTFTLMEEDLQTEVFSQSLDAFVSKYSSQPSMV
Ga0334977_0005215_4805_5308F000714N/AVEDATIPYTDTPLTKEETMEESTPAVTVPDTYNPNALVTYKVIRGYSDAEYATDKVTSIEWDLHNARQAQKQNAVLQDKINTAKDIIAEAYPDSQDQDTLRSIAEALGIELTRTVEWTATIEVSGTIELDLLEDYDIEDEITDNLYVDSQSGRIEIGDQEVCHVREC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.