| Basic Information | |
|---|---|
| Taxon OID | 3300033977 Open in IMG/M |
| Scaffold ID | Ga0314861_0043757 Open in IMG/M |
| Source Dataset Name | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2540 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Peru: Loreto | |||||||
| Coordinates | Lat. (o) | -4.0712 | Long. (o) | -73.2029 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007904 | Metagenome / Metatranscriptome | 342 | Y |
| F031329 | Metagenome / Metatranscriptome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314861_0043757_25_384 | F031329 | N/A | VHVCSGSVTTVVMVGDGISFWRNRLLERHMAEGEEEVVCEIARVVATCRDHLKSEIEALWIYVRPPAGSSLDKEIGDATGRPVRLLTCSASHAVALPPAEKKILEDFGVTFAGLLENHN |
| Ga0314861_0043757_389_976 | F007904 | AGG | MRVVLNLAIPPSARERYALYWAIPATLLGVSGLVFLLFFTVRSFREYRAVQASVAGYQEREKALGAQEMALRRQLEEPESRRLLDDVQFVNGLIEKKSISLTDLVTDITVLIPGEVRLTALALAPESQELVVRFVITGKSTEAIERFLSNLEDSPHFKDVAIINEGFEEAGTASELENIACTARYLAGGSELSGE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |