| Basic Information | |
|---|---|
| Taxon OID | 3300033977 Open in IMG/M |
| Scaffold ID | Ga0314861_0020494 Open in IMG/M |
| Source Dataset Name | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4188 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Peru: Loreto | |||||||
| Coordinates | Lat. (o) | -4.0712 | Long. (o) | -73.2029 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025877 | Metagenome | 200 | Y |
| F051554 | Metagenome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314861_0020494_1660_1974 | F025877 | N/A | MPGLEEGETIWRYRVQNPAKFDKMRVKDIGSGGVKITVGRVKGTNRWEIQNYMFEKQRFKTREQVRSWLDSHLKGQIQSLLDFKAWNEWRRRFVNAYVQISSVE |
| Ga0314861_0020494_3448_4188 | F051554 | AGTAGG | VQIRYFVPFRAQEGVDAQYALKEKLLNIEGVAVDSSVNLNKWQVPEEDLDFFVSTLIGAQLRIDHAESAMAVIGKVPEGKRLGSTVQFRAEIGDAAIIEKVIRGYLTHVSVQVDSDDVECSKCKRPTRKEGILVHLCPGAWEIVHKPKVRELSIVASPAYKNTTFAPLGFAAAMNEDQWGAVLNRVQVTEKYPVPPDQSSTDSRLLSGNKDVGSKGDLQEPENKTDEPKQSREVKHLSEQQTGQQEA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |