| Basic Information | |
|---|---|
| Taxon OID | 3300033977 Open in IMG/M |
| Scaffold ID | Ga0314861_0000842 Open in IMG/M |
| Source Dataset Name | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 44235 |
| Total Scaffold Genes | 43 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 28 (65.12%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Peru: Loreto | |||||||
| Coordinates | Lat. (o) | -4.0712 | Long. (o) | -73.2029 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020836 | Metagenome / Metatranscriptome | 221 | Y |
| F046782 | Metagenome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314861_0000842_41785_42198 | F020836 | GAG | MTLLVGAGVGLFLGPQQVLAQTCKDEVSMVEGSKQALVEFTETVKKESLRDFERLNHRKSALNKLTIHNSMLGGLVSCLEKAAQDTTAPKEQVEAAKAQHDASAKLQEKIQHERGAIKGAQVSKDAKALIEKLDLTP |
| Ga0314861_0000842_42494_42817 | F046782 | GAGG | MNRLAILALSVGETLFHEAGRLLFGIALGRAKELLRTPQPLGPRQLALNRALQKKAVDGALLEGPRTGKEYAKFTLKKGLPTDQRPRTLAVENEPHSVDRAGAPHAP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |