NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314861_0000206

Scaffold Ga0314861_0000206


Overview

Basic Information
Taxon OID3300033977 Open in IMG/M
Scaffold IDGa0314861_0000206 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)101690
Total Scaffold Genes104 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)64 (61.54%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-4.0712Long. (o)-73.2029Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000136Metagenome / Metatranscriptome1961Y
F000870Metagenome / Metatranscriptome851Y
F008506Metagenome / Metatranscriptome332Y

Sequences

Protein IDFamilyRBSSequence
Ga0314861_0000206_36411_36704F008506GGAMLDHTILKSVAEQLLGGAEVVVDGRASRVTRTGSRRFRTVRFVMGGREYQAIEQNPEKPSRWGKLAREGHRVVQFRDLMTQKYVAVTVDDKVTEYGR
Ga0314861_0000206_37072_37485F000870GAGMNDRKPDPQTLQESTARQMLWTVDRSFQGWTCSQCEWNYPVPTLLNDPEAKNAYDRLSAAKFRQHKCSDHASRLAPTGGESFTARIRKMVAHGFKPKDAVELVLQEAAIEYRNQPKVLDQARAEGEDFLRRLRAGLI
Ga0314861_0000206_47091_47480F000136AGGAMAKGKLKILYGEGDGETLKAQAAAMEKAGHTVQPAEGRKAVEEAINKSAFDLVILGATLTRNDRHHLPYMVKKASAETSVLVMHADGSRHPYVDACTDTGASLETVLTRIEGMKIAGLMPAAAAAGAGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.