NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314861_0000125

Scaffold Ga0314861_0000125


Overview

Basic Information
Taxon OID3300033977 Open in IMG/M
Scaffold IDGa0314861_0000125 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)129940
Total Scaffold Genes130 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)85 (65.38%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-4.0712Long. (o)-73.2029Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000132Metagenome / Metatranscriptome1972Y
F000214Metagenome / Metatranscriptome1570Y
F000771Metagenome / Metatranscriptome897Y

Sequences

Protein IDFamilyRBSSequence
Ga0314861_0000125_114445_114792F000132AGGTGGMLIEKLAAGVVQVQTPIGPRYLTASFIQRVYLLWMFRNFPILPHAVLSQRQQRLIDRMCSEQRFVSMLYAHAANDLPVIGTIEHRPPVGVDPLPPRRPVARETAGSLPAEVRQRS
Ga0314861_0000125_120059_120319F000214AGGMKNVYEVLRQKEMELTRLEKEVEALRLVAPLLSEEKEMISDMAKPALATAVNGPQPTGRIPVPTTPIPAPQPVRAAGWEDTAKRWP
Ga0314861_0000125_42502_42759F000771GAGGMKNLLAVLALALAFVAGAAVSAQVRDWHDLDAVHKHVVEAIHEMERARAANHYDMEGHGAKAEEHLRAAERELGLAVDAAKASAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.