NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247829_10156854

Scaffold Ga0247829_10156854


Overview

Basic Information
Taxon OID3300033550 Open in IMG/M
Scaffold IDGa0247829_10156854 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1778
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000805Metagenome / Metatranscriptome883Y
F001079Metagenome / Metatranscriptome785Y
F001935Metagenome / Metatranscriptome615Y

Sequences

Protein IDFamilyRBSSequence
Ga0247829_101568541F001935N/AVYVRHVTSLQFLTYLSFFAVLLAAMFRFVPGRTPPTRDEPYSDEELHAHDRKAAKYFLAGGFFLVLGSLHMVLKNLPWVSEYLARTGDAGHLVRDLS
Ga0247829_101568543F001079AGGMEPSLQSTSALPYVAWSSSSSARIPAEQWPLVFGSMQALKGHVQEYPGCQKLEAFVAPSGSDYRLHCYTTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF
Ga0247829_101568544F000805AGGAGMRMPSGDSPAKAQAYYHYLNAHQLTMQRPATWEVRWLDLAWLWGFAIALSVVILLWVWQYRSTRQKANIYPVDSFGGYTTELAGPATAFFLVLTVGLTTFAVVLIVGHIVWGQVF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.