NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316624_10006587

Scaffold Ga0316624_10006587


Overview

Basic Information
Taxon OID3300033486 Open in IMG/M
Scaffold IDGa0316624_10006587 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5535
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3776Long. (o)-82.512Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032325Metagenome / Metatranscriptome180Y
F070273Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0316624_100065876F070273AGGAGMRKEQGGPFQLNFEFAADHQVRVAESCLLQLTQYYCANCNKPPGKGAWSRSAAEASLACLLICESYACFLSDEAINALLSCRKAIPSSNNPVLWLDVLPWDLAIDALRSNPGRTEKQLEFNYSGKYWVLAPSGMSMSPVNFLVENLTYPNSSIRSVILELAWFVRKRIPSEKAAKALLKNAADTLSYWDRSLGLCSTLFENEEQFWAFADTFQAPHDFIEQYQDRLKVAHENKLRALRCHFIELELKLRRMIDGWALSLKFE
Ga0316624_100065877F032325GGAMDYRLLNGKPRATLIQRFDGTAVLLGPKARRLEFRLGATLHEIQAEADFVGWVVAIEHLHKEREGRTG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.