| Basic Information | |
|---|---|
| Taxon OID | 3300033475 Open in IMG/M |
| Scaffold ID | Ga0310811_11006419 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 728 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -78.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024344 | Metagenome / Metatranscriptome | 206 | Y |
| F048293 | Metagenome / Metatranscriptome | 148 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310811_110064191 | F048293 | N/A | QEDTMEATARELPFPVWLAAIFGFAKAGFLALMGVIGVLAWDGVTDPWGIGSLIMAALFGIASYMLMRGNRVARIVLAALAVIGGATAIVFAFIGPTSAILPSITTAVLAAIVIWLLYGLRSSKEYFGT |
| Ga0310811_110064192 | F024344 | N/A | NTTVAFLRPGASGAPEVVVNFGPLTGREATLAEIDRLARRLLEVASRVRVHAVRTHDMTPETETIVHQVVAEADAAASDAGRLRDICEDWAVDCAEERSLEPLGL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |