| Basic Information | |
|---|---|
| Taxon OID | 3300033412 Open in IMG/M |
| Scaffold ID | Ga0310810_10115923 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3170 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -78.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021874 | Metagenome / Metatranscriptome | 217 | Y |
| F044133 | Metagenome / Metatranscriptome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310810_101159231 | F044133 | AGGAG | MTAIAIRFPDESVELDNVEEHRVLTTLEVIYEGGSLHGKTADFPTRDVERVVVGLHLPNWHFFETYKRTICVDIRSQRTIF |
| Ga0310810_101159235 | F021874 | N/A | MKQTKIIAVISVVCACVAAPSLNAATLPAGTTITVSAVSSFSSKTVVGRSWEGKLAQDVSVKGHVLLKSGGKVFGKIASSRYNPRKNDPLTVELTSVSVNGRNVPVKTNAFQPGHRAMTGRQAQYGHTAGTLVITPGTLMQFQLLQPVTL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |