NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326728_10000553

Scaffold Ga0326728_10000553


Overview

Basic Information
Taxon OID3300033402 Open in IMG/M
Scaffold IDGa0326728_10000553 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)146724
Total Scaffold Genes125 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)98 (78.40%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042139Metagenome / Metatranscriptome158N
F075580Metagenome118Y
F104299Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0326728_10000553100F042139GGAGGMARVFTAQQLSDFLFDRIIVNCPKCQDVGCLKIACTLTAEELLEEADIVHKLEPVSDGGA
Ga0326728_1000055330F104299GGAGGMVMRRIVLTGLLLCTLQLSRTTFASPPPAVPDPSAQDMFTVEGKITEKAEGKLTISSGENIIFHILYNDKTEIRKKDGSLGTAQDLHAGLRVSIAGDLAESGEITAKKIEIEGEGSDKQ
Ga0326728_1000055388F075580AGGAGMLLKTHGEKMTENRSLAMLMKSNELKSLSGDVYDNKGENR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.