| Basic Information | |
|---|---|
| Taxon OID | 3300032770 Open in IMG/M |
| Scaffold ID | Ga0335085_10001496 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 48890 |
| Total Scaffold Genes | 46 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 30 (65.22%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida | |||||||
| Coordinates | Lat. (o) | 26.5052 | Long. (o) | -80.2345 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001303 | Metagenome / Metatranscriptome | 727 | Y |
| F070950 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0335085_1000149621 | F001303 | GGA | MHTGNLCAEPPGCDLGQERRGPMDRENKESMDEIHLRILRVTEDMRAIQRELNCAAMQAPNDPELMEALSDQPEMESIQVLKSALDQMRHFLWFYMQVMTSGSEMGEKLRQSLRQDTPTAAEAERQQQFQNASDAIMLRYLADSKFRKPN |
| Ga0335085_1000149634 | F070950 | N/A | MFPHRGPGDIMKQVLAIVLLVSAAAAQNLVAPSSTLPDAPSHEQPFWTIETKIDTGILAGLVATDAITTQRGLERGFREANPIMRPFVTRGTAGQAAGSAIGFGAAMGTVYLLHRTHHHKAERIAMRLMIGVQSAVVANNIAALR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |