NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335085_10001236

Scaffold Ga0335085_10001236


Overview

Basic Information
Taxon OID3300032770 Open in IMG/M
Scaffold IDGa0335085_10001236 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)57407
Total Scaffold Genes54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)43 (79.63%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5052Long. (o)-80.2345Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000978Metagenome / Metatranscriptome815Y
F013561Metagenome / Metatranscriptome270Y
F014062Metagenome / Metatranscriptome266Y

Sequences

Protein IDFamilyRBSSequence
Ga0335085_1000123625F013561GGAGMSDMQADLLKSFRAFIQAAEDGAVIPPVDEHDLKALHELCVERAKRYCGKDGVISIESTARACSPTANLPAVWLRHTQVRSLFRNGVLAEWQHGTTLDDAVFRLAARIPLTGTHMDAQTFLRELRAATVA
Ga0335085_1000123633F000978AGGALQPTCCLRCRREIEAGDKSVAVYMFAQTVGVKPRQKSTAQRVCFCPQCAVSLAMGLPPEGALNMVAWEMIRDLVSSEPSLNQAAWESLRGIVGLLPAGKEESSGRYRRVG
Ga0335085_100012369F014062GGAGMAANRQQGTYVGTSLLGFTALVGGLYNGGAWLLASAVGAALLLYSGFGFYRAKGVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.