NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316198_10192430

Scaffold Ga0316198_10192430


Overview

Basic Information
Taxon OID3300032251 Open in IMG/M
Scaffold IDGa0316198_10192430 Open in IMG/M
Source Dataset NameCoastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1183
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Calotrichaceae → Calothrix → Calothrix elsteri → Calothrix elsteri CCALA 953(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameNetherlands
CoordinatesLat. (o)51.4666Long. (o)4.071Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001139Metagenome / Metatranscriptome767Y
F006223Metagenome / Metatranscriptome378Y

Sequences

Protein IDFamilyRBSSequence
Ga0316198_101924302F006223AGGMTKEKTIKLSDYFGEKEYTLKEFQKRWSSPVNEIWAFLIDHGDKEERELGQKLAEEIFPKVAEKAFNKFYERQKK
Ga0316198_101924303F001139N/AMRIKHRDLTHYFLREHSQLPRAYVASCEKFFKELSGKQQATSGKLQASSNKFLLHKPGTRVKNRFNRKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.