| Basic Information | |
|---|---|
| Taxon OID | 3300032160 Open in IMG/M |
| Scaffold ID | Ga0311301_10501389 Open in IMG/M |
| Source Dataset Name | Sb_50d combined assembly (MetaSPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1799 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Weissenstadt | |||||||
| Coordinates | Lat. (o) | 50.1318 | Long. (o) | 11.881 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001558 | Metagenome / Metatranscriptome | 671 | Y |
| F008980 | Metagenome / Metatranscriptome | 325 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311301_105013891 | F008980 | GAGG | MMGAASRNLPEPPAREYIGRVFSQHREELEWLANFLTGDEKIGAACLVDACALAESEDAGFQEWLLKCACLATIRSAVQIQQRRIVQLSFAYKQRPCTHGGHMALSSDWREILVEESSVVIAKLDVLCRSALVICGLEKRSAYEAAVLLGIDPAGVEGAYCAAIKSLEV |
| Ga0311301_105013892 | F001558 | GAGG | MLRVQTQELDGALICRLEGRFTGKGAEEVRTLVTRCDSKLELVVDLTDVMFIDAIGEDVLLFVKRLGAQFVAETSYSRDVCERLQLPFIGKRKSNMQVPGNSDGNGHRPRLR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |