NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311301_10003053

Scaffold Ga0311301_10003053


Overview

Basic Information
Taxon OID3300032160 Open in IMG/M
Scaffold IDGa0311301_10003053 Open in IMG/M
Source Dataset NameSb_50d combined assembly (MetaSPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)62601
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)48 (82.76%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044711Metagenome / Metatranscriptome154Y
F047250Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0311301_100030535F047250AGGMSASENRVVFCAALRTARVFGWMLIALAILGIPQMRFLIGRVALSFGLLSSITLGLAGVAWLVGVKLFLRFFDRYLSRN
Ga0311301_100030537F044711GAGLARSLAEVYNFGTRLALQTEGSSFRMTVDFRAGLGRAAKALTYALLGAFVFWTPNVLVHWVIAYRFSGLVVLGLTVLLPVTTLLFFRIFLWPSLKQERRLSLALFAVLGIWIAGPSMLTFSSSFCGGGLTQPDAWRFFVFGTLLFPLFTLVMSAYDGTFFALLLTTLLLPILANSRFKITAGSDRAHQGT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.