NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315292_10354196

Scaffold Ga0315292_10354196


Overview

Basic Information
Taxon OID3300032143 Open in IMG/M
Scaffold IDGa0315292_10354196 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1229
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5395Long. (o)-110.3891Alt. (m)Depth (m)61
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000332Metagenome / Metatranscriptome1283Y
F002933Metagenome / Metatranscriptome519Y
F021729Metagenome / Metatranscriptome217N

Sequences

Protein IDFamilyRBSSequence
Ga0315292_103541961F021729N/AFTVILLSFLAFAGYFAWDSRQVILHAITAQDKMPQLAKQEQLIMPARSLMKDVDGIVLLIHKANLATNSRTTVLALNADGTREKAIEGTVTSLFNASSDRNAAMVAMLNNEVLCEEFSPSSKVGEWGIKQGVKFMCRGSIPPDPGKFAGYIAIGFKDKPEDIPALKTRINLAASDMSED
Ga0315292_103541962F000332AGAAGMRWLILLLLLGLVSATAKNGCQVIEFYSIAFSRHNPSERHQQLSIWLTNNAPHCKSQDLVIIWNNVSAWAGTADSAEIRNKIIQGYQDAIEREKK
Ga0315292_103541963F002933GGAMIPPIHKWYPMVQPEGYPNRTDALERRAERLQEEYAQALKMRKVKDKIDDLEFELYVKKAERNQLSLEIFTNRKLDVLV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.