NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315338_1020785

Scaffold Ga0315338_1020785


Overview

Basic Information
Taxon OID3300032138 Open in IMG/M
Scaffold IDGa0315338_1020785 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3092
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6953Long. (o)-122.3565Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006865Metagenome / Metatranscriptome363Y
F010325Metagenome / Metatranscriptome305Y
F037421Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0315338_10207853F010325N/AMLRKELVSDKLDQLQLAVERLKSSLVVPTDPSDVGTPIQVVVNVLQGIEDQIDAIVNLIELEND
Ga0315338_10207855F037421AGGAGMSDKPEHSSHFKELIRRLKELRISAESGEIVVPNDNEDVLNFHELELPITPATFHKMSSEEKEALFIWLNKDNMPQA
Ga0315338_10207856F006865N/AVSDRIINIQDTLYYILGTMSVKSSNERGTEYWKKQWGANSVLRNGDLYYYCSRVIEAEFEDI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.