NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315338_1020562

Scaffold Ga0315338_1020562


Overview

Basic Information
Taxon OID3300032138 Open in IMG/M
Scaffold IDGa0315338_1020562 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3118
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6953Long. (o)-122.3565Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005149Metagenome / Metatranscriptome410Y
F015796Metagenome / Metatranscriptome252N

Sequences

Protein IDFamilyRBSSequence
Ga0315338_102056212F015796AGGAMNKYQMKKYDDTKDRVLIREWFKLKGVVLEHGSKYGVDLEGKDYDVEISHLSFDRLWNQWKKENRFRIEIRKRNHYWDGIYNESKTTHFVQLNKSGHELLVYPQDLIMEYSNNEVELGYLRSKGFNLKERTFMSIPFSIGKDVIKRYEI
Ga0315338_10205627F005149AGGAMKTKCLLCTALTYPGQEFYDHLEDVHMMPIRRERIVQPENWIHGMSLEKKGMIREETHDECMERFKFNHPEYGTDLCWCPDCVGGETLTMVNKVCSEHGQLYIKGEHKND

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.