NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315338_1012985

Scaffold Ga0315338_1012985


Overview

Basic Information
Taxon OID3300032138 Open in IMG/M
Scaffold IDGa0315338_1012985 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4455
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (45.45%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6953Long. (o)-122.3565Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015347Metagenome / Metatranscriptome255Y
F029468Metagenome / Metatranscriptome188Y
F058443Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0315338_101298510F015347GAGGMSTLHLRCQRNAKMLLDSASEECKQMHMDAKEDAMYPDMDTIYSSAEEMRRFADRLNNFADELMVVYRKMDHHQHMIELDDLRSESYAN
Ga0315338_10129856F058443GGAGMRTRGQTVRLKNKSTGDEVRLLVILSDSKQGYLASDSLNKAREGNWAWYNLNEWSEIK
Ga0315338_10129857F029468GGAGVTFEIRLKEQAEHEFDKFDVEDNQLKMNEACTGFVSEFIDCEGEVYYSTAMKAMNAVWQYERSVKDSAATMVGPEWDRDKGVVGKWRYPHLRKNDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.