| Basic Information | |
|---|---|
| Taxon OID | 3300032134 Open in IMG/M |
| Scaffold ID | Ga0315339_1039084 Open in IMG/M |
| Source Dataset Name | Ammonia-oxidizing marine archaeal communities from Pacific Ocean, United States - ASW #17 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1866 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 36.1202 | Long. (o) | -123.4856 | Alt. (m) | Depth (m) | 200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003515 | Metagenome / Metatranscriptome | 482 | Y |
| F009537 | Metagenome / Metatranscriptome | 316 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315339_10390842 | F003515 | AGGA | MKTLIKWAILCSLTLGLNAFAGPPEGMVKQMIPFPAMCLPATVEKHHFAALMGALINDYGVHISMTFSATLDQSKRVAIIENPATGLAGVLMIMDDQTCIAFSGEDRQVYIRPPDHPVGAENEAPKT |
| Ga0315339_10390843 | F009537 | GAGG | MNVDSRIITLALFLIAQSVGAIWWASGLSSEVNRLSGLVDKSDQFQTEIQRAVSGLDVLNFKVEELWKAIERLEEADIVLRDVDSEIMVQHETIFAWLAEGDAEQTAKGNPYD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |