NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315284_10396419

Scaffold Ga0315284_10396419


Overview

Basic Information
Taxon OID3300032053 Open in IMG/M
Scaffold IDGa0315284_10396419 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1704
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.508Long. (o)-110.3268Alt. (m)Depth (m)93
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004451Metagenome / Metatranscriptome437N
F008079Metagenome / Metatranscriptome339Y
F012974Metagenome / Metatranscriptome275N

Sequences

Protein IDFamilyRBSSequence
Ga0315284_103964191F012974N/AMFTEAEQVIIQQVFTLAEKEQSYKINLIKLKAIKDRLLGYEKECFCSSVRRKIWFKDFKQWYETFT
Ga0315284_103964192F004451AGGAMRPLLDNYISAHYKEIRKYTNYFLVRMKSTISADAVINNSFLYLCNIDIEVTDPGKVKAYLLNTIKMQILWSTSLTNRQERVTATDSTMPIVIDDDTHLSDKIREDIRYQDNMAVIEIYRGRITDRIKLIVFQTYFDKGYSTARSMAEYFKIPVTSAHYWIQEIKNDLKQLRDEN
Ga0315284_103964193F008079N/AMKIKNEFIGVKVSHKGNNVNVSTENYTFCESIGLGYMFEEPTVTELKVVKYKAVKGPIPEPVVTEEDGTEAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.