NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307409_100001773

Scaffold Ga0307409_100001773


Overview

Basic Information
Taxon OID3300031995 Open in IMG/M
Scaffold IDGa0307409_100001773 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10906
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013696Metagenome269Y
F018752Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0307409_1000017734F013696AGGMFAAVLRDAWRQYRRRPLAAVLAVVVGGLPVFLEPDEPLLAVPLAVILLAAGLLVELFLVSWLASAIDPAPPPTPAAAALATMRRTIGPGVRAGLLRAFYLLGALMVGLLLFGSRESGPLPSSEQTKLAIGLWPLFGFAFAFLAVLMQRVVLGGERKVRQAASVSHRVASAHFPLCLLIGLLQASGLVLASLVVEFWALAVLSILLALADPYLIGMSNALYLRTRADQEPVDAGDGSLRPPHM
Ga0307409_1000017739F018752GGAGGMDWDRDRDLDGVPDWQEDENYADEAPIAGPGSPRARMRGGGCALPVALLLTGVAMAARRASRGRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.