NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315297_10281756

Scaffold Ga0315297_10281756


Overview

Basic Information
Taxon OID3300031873 Open in IMG/M
Scaffold IDGa0315297_10281756 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1383
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.536Long. (o)-110.4254Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000403Metagenome / Metatranscriptome1177Y
F001897Metagenome / Metatranscriptome620Y
F003182Metagenome / Metatranscriptome502Y

Sequences

Protein IDFamilyRBSSequence
Ga0315297_102817561F001897N/ASILVRAAAWRNQTETEPAGIDFAFGYQAAYNANMKRWFVEDTVTSALMRVMALVMGNTEKATKEVMALVKTETPAADYDYWTTKHGDVPSYKTAGEAEMAGTPSFGSSDEPGWSIEAKQTCLHGAMRWNQSKPDAAKSWGGYFCSEKIKEKQCTPRWYVLRSTGKWEPQI
Ga0315297_102817562F000403GGAGMSDYMEIINPQTRIARLYYRGEVVEEYKVEQCDKCSKLTKFDKFGYQKGYDNADNIIWFCGDCR
Ga0315297_102817564F003182AGGAGMHILLFDCSICSKLYGKPKQRHGLKKGAELTEHEWFAQCMSCGTFGIKIVDDARIAELSQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.