NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315900_10397161

Scaffold Ga0315900_10397161


Overview

Basic Information
Taxon OID3300031787 Open in IMG/M
Scaffold IDGa0315900_10397161 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1090
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000716Metagenome / Metatranscriptome923Y
F076942Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0315900_103971611F076942GAGMNSKAIVLADETGAVITVSENNSDYGYFRVQQARTMIDDSGFAHRKVLTALVPGLVEELKEMGLYANQQLDGKIIIQESLTPFNKKNPERDLKIAGETGVVCKLGGLPIYRRTKFSFNVNATDSTVDHDNIEELRAAYSAQEKAKAIQPNEDFSIEG
Ga0315900_103971612F000716N/AMEKLQQSVRDYQLQPGKYVEYEQDIYNSYQNYLYKRALYGLDALTQEELATMCSKKKQRIVNVYNRAQNILNVAKQKATIHYTNALFKTFFPESPLTQALLELTETDPKFKNTLTFKDLNIKKSDIISIFISEGILPKNFLSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.