NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10164206

Scaffold Ga0315907_10164206


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10164206 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1876
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001530Metagenome / Metatranscriptome676Y
F007521Metagenome / Metatranscriptome349Y
F018704Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0315907_101642062F001530N/AMQITKEFLEVEISDLEQEAHKAQTFLIQVQATITAYKMLINRLDAPDTENTNELQ
Ga0315907_101642063F018704GGAGMSYSNLSAVTKTADDDAISGRTRVAAIYYTCAGTASSFQLKNGTTSAGTTLVDIKTPGAAGAYDIIFPDMGVLFDEGVFIDFADANVLSITLFFYGGAAV
Ga0315907_101642068F007521AGAAGGMAGRGMGCATRGGGAVESGPKNRMISETSKKTGPVMMKDGGVVKPHKMMAMGKKPKKMMGGGMMKGYKMGGSACS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.