| Basic Information | |
|---|---|
| Taxon OID | 3300031758 Open in IMG/M |
| Scaffold ID | Ga0315907_10008463 Open in IMG/M |
| Source Dataset Name | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10567 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (76.92%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Lake Erie, Ohio | |||||||
| Coordinates | Lat. (o) | 41.6898 | Long. (o) | -83.2813 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012428 | Metagenome | 280 | Y |
| F012448 | Metagenome / Metatranscriptome | 280 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315907_1000846310 | F012448 | GAG | MDIDAISKNPKYKKIDLDYVEFVEVDDIWVRSYTIPKSKTVLSQHVHTHPHVTLISHGAVEAWQDGESMGRFDAPAVITIPAGKKHAFMALTDDVTLCCLHNLRGTGLESPEIKEF |
| Ga0315907_100084639 | F012428 | AGGAG | MGMLQNQNAPNVPAAPMQYEQGFMNQYTNVLRLFFNQINAIQQLNLARLNLDLGTLPTDADYDSLRFGDVYRDTQGGTLQTGSNLLRIKVPVQLSGVQGAGAVGSVGPVGGTITKGLTGVTSTGTVGTVTP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |