NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302321_101141522

Scaffold Ga0302321_101141522


Overview

Basic Information
Taxon OID3300031726 Open in IMG/M
Scaffold IDGa0302321_101141522 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)891
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001063Metagenome / Metatranscriptome789Y
F058364Metagenome / Metatranscriptome135Y
F090967Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0302321_1011415221F058364AGGAMTTRLEEKDLKRQSRRQLLKLAPVAVLGVFAFPKVNQRLVAAGVRFSDWASGGLFRSQHLAQTFSNSEVVPFAEFPYNGYDVLDPEVDLEKWTLTVEGDVQHPGE
Ga0302321_1011415222F001063AGGAGMETMLQGLVIIGGLTFSVAASLLIEELIFGQIVRVAFARHPQIPKPRQ
Ga0302321_1011415223F090967AGGAGMLLKCWLLSAGIAMFIIAAGIFTYDVFLLIAYQRRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.