NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315539_1072355

Scaffold Ga0315539_1072355


Overview

Basic Information
Taxon OID3300031650 Open in IMG/M
Scaffold IDGa0315539_1072355 Open in IMG/M
Source Dataset NameSalt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-150
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1312
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.722Long. (o)-70.847Alt. (m)Depth (m)1.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047751Metagenome149Y
F072485Metagenome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0315539_10723551F047751AGGAGGMPEELPPELKESIDEFYLETSPEIKDLIHGWLYKIVAAAYEGIGELPPEHRDRILMKISKACSDQAKMVLGCPPGMGWEEYKKHMAELQPPFGPRKIAQIGDIVHWTYVPPKDKDGRPICQCPLIRFGWMEPRPEVCACSANSVASYIEEFTGREVATVETLGSPMVGGEEECR
Ga0315539_10723552F072485N/AMLYLYENITIFSRFQEEFWKVMGTDYVPDAERNGLRLVGMFMVGIHYNENLALWEVDDWAALDRIQEFHDKDPLAKVWEREAVDYRTDWVGKVLEPAPFSPTLAQIKEGDYKSTIYLHTLARVVPGKAEEYIDAIGRGLMPMAQTWGMKLVGCYHAVAGTASSGEVVNIWTAGNIHGDWVKIREASLNDPAYKDWEAKAGKWRPKVVYRFLYGLVPYSPLRTPFLADEVAAEEVRTVAMPEVEWGKD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.