NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308009_10023646

Scaffold Ga0308009_10023646


Overview

Basic Information
Taxon OID3300031612 Open in IMG/M
Scaffold IDGa0308009_10023646 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #127
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2418
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004102Metagenome / Metatranscriptome453Y
F096226Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0308009_100236461F096226GGAGGMIYDEGFSRRKILSLSKKDLESIICIVCSKRYGEHTKGNSPKFSLRELMVCMFRIQGTLVSDGINN
Ga0308009_100236466F004102N/AMVEIRKSVASALNKALNMVNKNYTETTTRPSVAQPYMSTDTGAKLPIFPFPLTMIYELADNIDALRIPIETLNREMFKNGFEVVEKWKYKCMNCSKEFQYAPTADNPDEQPFEANGDSGGAHPRKKKSADVPSAHALVCDTCGSNDLVRPVPEHRKTLENLMNEPVNSNQQTLEDVARQLERDFEIADNAYLLLLKNYKIDDVTGKIDQEKTIIKEMLRIEPPQVAMIADSDGRIGYDDKRNKIFVCPRFEHRDARLVEPKCDRCGAEALKAVIEVNSVYSIGIPQPKRVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.