| Basic Information | |
|---|---|
| Taxon OID | 3300031565 Open in IMG/M |
| Scaffold ID | Ga0307379_10030684 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6476 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 15 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Risofladan, Vaasa | |||||||
| Coordinates | Lat. (o) | 63.0472 | Long. (o) | 21.7116 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018178 | Metagenome / Metatranscriptome | 236 | Y |
| F097396 | Metagenome / Metatranscriptome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307379_100306842 | F097396 | GAGG | MNLPERELNHPEWYARDLGACSQCNEPMLQVEDEGHHIIACRVCDLGGVADNDRKFSVHFYGLKDGEDLHSFENGIIADSRTEMQELADWWEENMHWEVLQVQGNRDKLVKADVLEGNPAQQYWIYEQDQEIACIVEVL |
| Ga0307379_100306844 | F018178 | GGA | MEDKLDRILERLSQRINEWEGASVEAIEAETNFKSYEAATKKAYMDTGESAAKSEVQARSSREWAGYYQAVQLANLKAEKYKKQIMLGQLAFDAERTKQANLRRVV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |