Basic Information | |
---|---|
Taxon OID | 3300031463 Open in IMG/M |
Scaffold ID | Ga0272448_1120133 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1582 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.5676 | Long. (o) | -110.8075 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006925 | Metagenome | 362 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0272448_11201332 | F006925 | AGG | MAEVSVLENFGREAELRKKWMLMWENLGKRILKMPKWMQEIVLEDINTAIRNRIAIMEMIQNAKRNH |
⦗Top⦘ |