| Basic Information | |
|---|---|
| Taxon OID | 3300031449 Open in IMG/M |
| Scaffold ID | Ga0272429_1011107 Open in IMG/M |
| Source Dataset Name | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9878 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Victoria Land | |||||||
| Coordinates | Lat. (o) | -77.7 | Long. (o) | 160.75 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018488 | Metagenome | 234 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272429_101110711 | F018488 | GGA | MEPTRRPPPVVAGWNEQAAVALLVVVAGHLLAVEAGPLTPARLVRSVGAYHDDLPALVAVLEGSPSAPVRHGTQQLRRLIRAGQAQVYRRVLPGLPVALADSFFRLDLVKTTAHAGLDLFRPAS |
| Ga0272429_10111072 | F018488 | GGA | MGPTRRPPIEGPGWNDRAATAILVLVAGHLLATEPTADPLTPDRVARVVGAYQDNLPALVVALEGSPSDQVRHGAHQLRRLIRAGQAGVYQRVMPGLPVALADPFFRLALARAAAKTGLDLFPPDQAGR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |