NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265327_10014569

Scaffold Ga0265327_10014569


Overview

Basic Information
Taxon OID3300031251 Open in IMG/M
Scaffold IDGa0265327_10014569 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5134
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → Candidatus Eremiobacteriia → Candidatus Eremiobacterales → Candidatus Eremiobacteraceae → Candidatus Eremiobacter → unclassified Candidatus Eremiobacter → Candidatus Eremiobacter sp. RRmetagenome_bin22(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064923Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0265327_100145691F064923N/AFATGESNRMKSLGRLLAATLVGLAAATATIGSAQAAAPILIKSCTIAKPKPLSHVAGGTTVSYVNLGNKTAASVTFLVGYRNAQQNYLRRVSDIGSFAPGATITHTLQLYNDVTYAGAQTSSCVPIEVKWAGGTVWMAPSSH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.