Basic Information | |
---|---|
Taxon OID | 3300031223 Open in IMG/M |
Scaffold ID | Ga0307981_1024242 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #987 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2471 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Organic Lake | |||||||
Coordinates | Lat. (o) | -68.457 | Long. (o) | 78.1911 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001864 | Metagenome | 624 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307981_10242422 | F001864 | GAG | MTRYTFEIDTENAIRIWDSENPNDSGAPFMFQPDWPDVTPWADAAQATDWAEVFIASLVDPESELVAGNSPDTHPAIRPEPEPEIAPE |
⦗Top⦘ |