NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073994_10031809

Scaffold Ga0073994_10031809


Overview

Basic Information
Taxon OID3300030991 Open in IMG/M
Scaffold IDGa0073994_10031809 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)717
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameUSA: Montana
CoordinatesLat. (o)45.7544Long. (o)-113.9094Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000072Metagenome / Metatranscriptome2651Y
F000540Metagenome / Metatranscriptome1043Y

Sequences

Protein IDFamilyRBSSequence
Ga0073994_100318092F000540GGAMAKKKAASLLPKLTEAEQDLLSHIQDGYQLQTDSLGGNPVLRRLKDNEEIRPLSANRNTIKAMERRGLITPGKGRDLLTIVWRLKKKIN
Ga0073994_100318093F000072N/AMDAEQTIAEIEWLERIFAAPDARPLSASDLSAANRRHDEMLAQSPWFRLWHRYGLSCRSESPVIRLGEVEN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.