NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316363_10235122

Scaffold Ga0316363_10235122


Overview

Basic Information
Taxon OID3300030659 Open in IMG/M
Scaffold IDGa0316363_10235122 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)751
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F021252Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0316363_102351221F021252GGCGGMGDQAERVVLEAEDQVNPVVDKANAGLDSFEKKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGKSGVDRLISQRDQLLQRYAKEPAAIDAITRSYEKMI
Ga0316363_102351222F000451N/AADAIRARIQSGQNIYDQAAAPLKPGKPGRRGYPDYKSARGLQPIRDWTWSGHTLRCLKVLTVNENRAVIGFLDEAMPGRKQTASQIAFYNNQREHQWGVSPRDRSALLAVMVGYRPLVVAAGGTELAGYRQYGAAVYFSALRPAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.