NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247628_1261256

Scaffold Ga0247628_1261256


Overview

Basic Information
Taxon OID3300030569 Open in IMG/M
Scaffold IDGa0247628_1261256 Open in IMG/M
Source Dataset NameMetatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)516
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Rollainville
CoordinatesLat. (o)48.3625Long. (o)5.7397Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000206Metagenome / Metatranscriptome1598Y

Sequences

Protein IDFamilyRBSSequence
Ga0247628_12612561F000206N/ALFAIFAAVVVAQKTPVWPKAASTSIFAHSWSRRGENDFIRWWFDASLGKERIDGPREFLGEFFWTTTILDTKTKRETFIIHQESLIACYQRASNGTIPSPNFANARYAGKAEIELDVVDHWIERDPMRGRDFLQIFDRQDNGHIIRMDHDDERRGHSVTFRFHEWSIAAQD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.