Basic Information | |
---|---|
Taxon OID | 3300030114 Open in IMG/M |
Scaffold ID | Ga0311333_10956258 Open in IMG/M |
Source Dataset Name | I_Fen_E2 coassembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 724 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Abisko, Stordalen Mire | |||||||
Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0469 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059555 | Metagenome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0311333_109562581 | F059555 | AGG | MNKINYLALGAVAITLFAVFSPWLEVSDSGNPSGESFQPMIIHGISMGYGIFGMLLALIGGFLVYKENKWTFVAGIVNFINGYGYLHEWFGKGTHDSGNYGDVTSRSIVEPKFGIYLFIFATLAFIVFTLKYYKMKKA |
⦗Top⦘ |