NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168096_1026540

Scaffold Ga0168096_1026540


Overview

Basic Information
Taxon OID3300029942 Open in IMG/M
Scaffold IDGa0168096_1026540 Open in IMG/M
Source Dataset NameBiosolids microbial communities from sewage treatment plant in Sweden - SWESTP8 - Uppsala-digested 109
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Gothenburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1365
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)59.844519Long. (o)17.659844Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039408Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0168096_10265402F039408N/AQMAGVALIQPDLAADFTVMPEVDKGAKAFFERFYRRRKEIKAAEPKQAIKLALSCIPSAYDLQHFTLAIDDRYAEKEFITQELAVEIEQNLTALRTSRKAAAWLEKSDLMRVIAKEVDYGVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.