| Basic Information | |
|---|---|
| Taxon OID | 3300029913 Open in IMG/M |
| Scaffold ID | Ga0311362_10150368 Open in IMG/M |
| Source Dataset Name | III_Bog_N3 coassembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2839 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Abisko, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0477 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038038 | Metagenome / Metatranscriptome | 166 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311362_101503681 | F038038 | N/A | ASSGFSPYKVKGLALHLQYMNVTGEEIKEVVFDASTSYREHGAMGQSMVDNSNRSPITSTAPPGKWKKAEIDVGLSEPGRTRLRVAEVTFLSGRHWVNSTLDECEWTIEP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |