Basic Information | |
---|---|
Taxon OID | 3300029824 Open in IMG/M |
Scaffold ID | Ga0134852_102126 Open in IMG/M |
Source Dataset Name | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-1-30-B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chongqing University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 988 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Chengdu | |||||||
Coordinates | Lat. (o) | 30.65 | Long. (o) | 104.06 | Alt. (m) | Depth (m) | .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003987 | Metagenome / Metatranscriptome | 458 | Y |
F004383 | Metagenome / Metatranscriptome | 440 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134852_1021261 | F004383 | N/A | DNPLERAFMARIRADELRAELATLQKEFDEREDVVALKRRIDRCDHERQTCIEQAKIAGVSKVGNYLLKIRTRKTRTVVPKLFFAKHGAEAFVECCTVAIGKAEALLGKSALDDCCEVEVKEIGVTVEYERPENQGEVEDL |
Ga0134852_1021263 | F003987 | AGGAGG | MIPALPCGTFADSETPAGAFYIAAFEKGDTPHHVGEYRIDVVIRALQALKACGYDDVEVGSIFAPDPENVHLLLIGLDGEARFGDA |
⦗Top⦘ |